PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G241300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 562aa    MW: 62740.3 Da    PI: 4.5961
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G241300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.31.3e-1271925612374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAea+s+ + e+aq+++++l++ ++ +gdp qR+aay++e+Laa++++s++++y+al+++e++   +  +l+a+++++e++P+++
  Sevir.3G241300.1.p 192 KQLLFDCAEAISEYSVEEAQSIITELRQKVAIQGDPSQRIAAYLVEGLAATIQSSGKGIYRALRCKEAP---TLYQLSAMQILFEICPCFR 279
                         589*****************************************************************9...89999************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++++ aN aIlea +gee vHiiDfdi+qG Q+++L+q L + +++p  lRiTgv++pes+      l+ +g+rL+k+Ae ++vpfef++ 
  Sevir.3G241300.1.p 280 LGFMSANYAILEACKGEEVVHIIDFDINQGSQYINLIQFLRNNSNKPRLLRITGVDDPESVhrAVGGLKVVGQRLEKLAEDCEVPFEFRA- 369
                         ***********************************************************99888899***********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         va+++ed+++ +L+++pgEal+Vn+++ lh+l+desvs+ +erd++L++vk+l+Pk+v+vveq+a++n+++Fl+rf e  +yysalfdsl+
  Sevir.3G241300.1.p 370 VASNIEDVTPGMLDCRPGEALIVNFAFLLHHLPDESVSIVNERDQLLRMVKGLRPKLVTVVEQDANTNTTPFLARFREVYDYYSALFDSLD 460
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+ +aGF p p+++++ + +k+ll+ + +  yr e+ ++ l +gW 
  Sevir.3G241300.1.p 461 ATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMAMAGFVPSPFNSNVIDGIKSLLKSYCD-KYRFEKVHDGLHFGWG 550
                         ************************************************************************95.5*************** PP

                GRAS 364 drpLvsvSaWr 374
                         d++Lv+ SaW+
  Sevir.3G241300.1.p 551 DKTLVVSSAWQ 561
                         **********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.909165542IPR005202Transcription factor GRAS
PfamPF035144.6E-125192561IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MSFVRQADPS ASCAESPYIH KFGPPGSVFP AQFASGTELL HHGPQPYNAE GYRQSGFNGT  60
AAHAFQSSFY NTDSHVESHF NEATCSPANS NISQQNSQSL SDNQTADLEV EFDEDEMRLK  120
LQELEHALLD DGDEIFSDLS GIIDDEWNDN MKNNDWTNTM KNIMSPDSPK ESSPESSLCC  180
PDSNNGEARH PKQLLFDCAE AISEYSVEEA QSIITELRQK VAIQGDPSQR IAAYLVEGLA  240
ATIQSSGKGI YRALRCKEAP TLYQLSAMQI LFEICPCFRL GFMSANYAIL EACKGEEVVH  300
IIDFDINQGS QYINLIQFLR NNSNKPRLLR ITGVDDPESV HRAVGGLKVV GQRLEKLAED  360
CEVPFEFRAV ASNIEDVTPG MLDCRPGEAL IVNFAFLLHH LPDESVSIVN ERDQLLRMVK  420
GLRPKLVTVV EQDANTNTTP FLARFREVYD YYSALFDSLD ATLPRESPDR MNVERQCLAR  480
EIVNILACEG PDRVERYEVA GKWRARMAMA GFVPSPFNSN VIDGIKSLLK SYCDKYRFEK  540
VHDGLHFGWG DKTLVVSSAW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4521056122375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9485341e-119EU948534.1 Zea mays clone 379741 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962026.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLK3Z5170.0K3Z517_SETIT; Uncharacterized protein
STRINGSi021635m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1